PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.5414s0059.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 227aa    MW: 25982.5 Da    PI: 9.3204
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.5414s0059.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.31.5e-261059251
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         ri++++ rqvtfskRr+g++KKA+EL +LCdaev +iifsstgkly+++s
  Cagra.5414s0059.1.p 10 RIDDSTSRQVTFSKRRKGLIKKAKELAILCDAEVGLIIFSSTGKLYDFAS 59
                         8***********************************************86 PP

2K-box738.9e-2581157985
                K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 
                          + +++ + +q+e+a L++e++ Lq+++R+++Ge+L+ Ls++eL++Le+qLe sl  iR kK+++l+++i+el kke+
  Cagra.5414s0059.1.p  81 NPASEVKFWQREAAVLRQELHALQENHRQMMGEQLNGLSVNELNSLENQLEISLHGIRMKKEQMLTQEIQELSKKEN 157
                          567889*******************************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.02161IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.59E-32288IPR002100Transcription factor, MADS-box
CDDcd002651.28E-42278No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-27323IPR002100Transcription factor, MADS-box
PfamPF003197.9E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-273859IPR002100Transcription factor, MADS-box
PfamPF014862.4E-2284177IPR002487Transcription factor, K-box
PROSITE profilePS5129714.82386170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MGRGKIVIQR IDDSTSRQVT FSKRRKGLIK KAKELAILCD AEVGLIIFSS TGKLYDFASS  60
SMKSIIDRYN KSKIEQQQLL NPASEVKFWQ REAAVLRQEL HALQENHRQM MGEQLNGLSV  120
NELNSLENQL EISLHGIRMK KEQMLTQEIQ ELSKKENLDL SRKVQRIHQE NVELYKKAYA  180
ASTNGFIHRE RAAVTVTDDE SSQTQIRLQL SQPEHSDYET PPRASE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A8e-20269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B8e-20269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C8e-20269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D8e-20269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A8e-20269168Myocyte-specific enhancer factor 2A
3kov_B8e-20269168Myocyte-specific enhancer factor 2A
3kov_I8e-20269168Myocyte-specific enhancer factor 2A
3kov_J8e-20269168Myocyte-specific enhancer factor 2A
3p57_A8e-20269168Myocyte-specific enhancer factor 2A
3p57_B8e-20269168Myocyte-specific enhancer factor 2A
3p57_C8e-20269168Myocyte-specific enhancer factor 2A
3p57_D8e-20269168Myocyte-specific enhancer factor 2A
3p57_I8e-20269168Myocyte-specific enhancer factor 2A
3p57_J8e-20269168Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3369790.0AF336979.1 Arabidopsis thaliana MADS-box protein AGL21 mRNA, complete cds.
GenBankBT0248460.0BT024846.1 Arabidopsis thaliana At4g37940 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285120.11e-164hypothetical protein CARUB_v10006453mg
SwissprotQ9SZJ61e-149AGL21_ARATH; Agamous-like MADS-box protein AGL21
TrEMBLR0H3E71e-164R0H3E7_9BRAS; Uncharacterized protein
STRINGAT4G37940.11e-147(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53024105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.11e-151AGAMOUS-like 21